PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v0780580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 356aa    MW: 39009 Da    PI: 8.4036
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v0780580.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.27.5e-33220275156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+peLH+rFv+a++qLGG+++AtPk+i++lm+v+gLt+++vkSHLQkYRl+
  Lj2g3v0780580.1 220 KQRRCWSPELHRRFVDALQQLGGAQEATPKQIRDLMQVEGLTNDEVKSHLQKYRLH 275
                      79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.851217277IPR017930Myb domain
SuperFamilySSF466896.27E-18218278IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-30218278IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-26220275IPR006447Myb domain, plants
PfamPF002491.2E-7222273IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MDLCLDLSLA SSPSLFLGDV SRRSRDMSEK LAMLENYVQR LEDEMNKVEA FKRELPLCML  60
LVKEAIARLK EEKLQCLGKQ DPPAAAAAAA EESTPNCGAN GKGPGITMEK DKNNWMSTVQ  120
LWCAQTKSKN VEGDRSVPEK PIQLMNPNKT SVGGGFMTFI ADSRVPKEVS HVPSFKITPA  180
AQLSHSNSKS GCGGGSSSEL SQPQPQPPHH LLRQNQNPRK QRRCWSPELH RRFVDALQQL  240
GGAQEATPKQ IRDLMQVEGL TNDEVKSHLQ KYRLHVRRFP ISSNGQANNG LWMVQDQSGD  300
KSKGSLSQSG SPQGPLTPLL LGGSVKGLSS PGRNSADAED EQSDCWNWKG ADNQSL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0969301e-42BT096930.1 Soybean clone JCVI-FLGm-21I16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156835.11e-129hypothetical protein PHAVU_002G021400g
TrEMBLV7CFC01e-129V7CFC0_PHAVU; Uncharacterized protein
STRINGGLYMA01G39040.11e-122(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.13e-54G2-like family protein